PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof016469
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family MYB_related
Protein Properties Length: 186aa    MW: 21390.9 Da    PI: 10.9972
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-95366PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.96.4e-103678347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT +E+e + +a +q G++ +++I ++++  +   q++++++ +
        Sof016469 36 AWTHQEEENFFNALRQVGKN-FDKITHRVQ-SKNKDQVRHYYYRL 78
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.72E-113182IPR009057Homeodomain-like
PROSITE profilePS5129312.8523283IPR017884SANT domain
SMARTSM007178.0E-73381IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-63581IPR009057Homeodomain-like
PfamPF002496.0E-83678IPR001005SANT/Myb domain
CDDcd001671.04E-63679No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MSFTGSAPEP SDSNKKPVFA LCLIFIAKKQ TRQWAAWTHQ EEENFFNALR QVGKNFDKIT  60
HRVQSKNKDQ VRHYYYRLVR RMKKLLGPSF SLDAKNSKDT IAAMLRWWSL LEKFSCSASK  120
LHLKPRRFKT FVEALGKQLL KDSKSTRKRS RVDMCLPSPS PIVSKAPGNE TPVKLLSLYA  180
QNGSKV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002468193.11e-111hypothetical protein SORBIDRAFT_01g041425, partial
SwissprotQ8LJT87e-67TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLK7VFY31e-113K7VFY3_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G152319_P021e-113(Zea mays)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.24e-68TSL-kinase interacting protein 1